Solution Manual For 3-2-1 Code It! 2020, 8th Edition

Preview (16 of 274 Pages)

100%

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 1 preview image

Loading page ...

’s Manualto Accompany3-2-1 Code It!2020Michelle A. Green, MPS, RHIA, FAHIMA, CPCTechnical CollaboratorsMarsha Diamond, CPC, COC, CCS, CPMALisa Riggs, CPC, CPC-I, AASAustralia●Brazil●Mexico●Singapore●United Kingdom●United States62679_fm_rev03.indd11/20/205:09 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 2 preview image

Loading page ...

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 3 preview image

Loading page ...

PREFACEvSECTION IPREPARINg YOuRCOuRSE1SEMESTER PLANS3ADMINISTERING EXAMS5GRADING ASSIGNMENTS AND EXAMS5LESSON PLANS5SECTION IIANSwERKEYSTOChAPTERExERCISESANd REvIEwS27Chapter 1 – Overview of Coding28Chapter 2 – Introduction to ICD-10-CM and ICD-10-PCS Coding30Chapter 3 – ICD-10-CM and ICD-10-PCS Coding Conventions33Chapter 4 –Chapter-Specific Coding Guidelines: ICD-10-CM Chapters 1–1041Chapter 5 – Chapter-Specific Coding Guidelines: ICD-10-CM Chapters 11–2144Chapter 6 – ICD-10-CM and ICD-10-PCS Hospital Inpatient Coding48Chapter 7 – ICD-10-CM Outpatient and Physician Office Coding60Chapter 8 – HCPCS Level II Coding System67Chapter 9 – Introduction to CPT Coding72Chapter 10 – CPT Evaluation and Management75Chapter 11 – CPT Anesthesia83Chapter 12 – CPT Surgery I89Chapter 13 – CPT Surgery II94Chapter 14 – CPT Surgery III101Chapter 15 – CPT Surgery IV105Chapter 16 – CPT Surgery V109Chapter 17 – CPT Radiology117Chapter 18 – CPT Pathology and Laboratory120Chapter 19 – CPT Medicine125Chapter 20 – Insurance and Reimbursement127SECTION IIIANSwERKEYSTOwORKbOOKASSIgNmENTSANd REvIEwS129Chapter 1 – Overview of Coding130Chapter 2 – Introduction to ICD-10-CM and ICD-10-PCS Coding135Chapter 3 – ICD-10-CM and ICD-10-PCS Coding Conventions138Chapter 4 –Chapter-Specific Coding Guidelines: ICD-10-CM Chapters 1–10141Chapter 5 –Chapter-Specific Coding Guidelines: ICD-10-CM Chapters 11–21143Chapter 6 – ICD-10-CM and ICD-10-PCS Hospital Inpatient Coding146Chapter 7 – ICD-10-CM Outpatient and Physician Office Coding173Chapter 8 – HCPCS Level II Coding System180Chapter 9 – Introduction to CPT Coding185Chapter 10 – CPT Evaluation and Management190Chapter 11 – CPT Anesthesia196Chapter 12 – CPT Surgery I204Chapter 13 – CPT Surgery II207Chapter 14 – CPT Surgery III211Chapter 15 – CPT Surgery IV214Contentsiii62679_fm_rev03.indd31/20/205:09 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 4 preview image

Loading page ...

ivContentsChapter 16 – CPT Surgery V219Chapter 17 – CPT Radiology225Chapter 18 – CPT Pathology and Laboratory228Chapter 19 – CPT Medicine232Chapter 20 – Insurance and Reimbursement235SECTION IvANSwERKEYSTOwORKbOOKCOdINg CASES241Ambulatory Surgery Unit Coding Cases Answer Key (for Workbook Appendix A)242Emergency Department Coding Cases Answer Key (for Workbook Appendix B)245Physician Office Coding Cases Answer Key (for Workbook Appendix C)247Inpatient Coding Cases Answer Key (for Workbook Appendix D)250SECTIONvANSwERKEYTOwORKbOOKAPPENdIx E:mOCKCERTIFIEdPROFESSIONAl COdER(CPC) CERTIFICATIONExAmINATION253SECTIONvIANSwERKEYTOwORKbOOKAPPENdIx F:mOCKCERTIFIEdCOdINg SPECIAlIST—PhYSICIANbASEd (CCS-P) CERTIFICATIONExAmINATION255SECTIONvIIANSwERKEYTOwORKbOOKAPPENdIxg:mOCKCERTIFIEdCOdINg SPECIAlIST(CCS) CERTIFICATIONExAmINATION26162679_fm_rev03.indd41/20/205:09 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 5 preview image

Loading page ...

This’s Manual is organized into seven sections:●Section I: Preparing Your CourseSection I contains sample semester plans and policies for administering exams and gradingassignments and exams. Chapter lesson plans that can be modified for individual use areincluded.Note:●Section II: Answer Keys to Chapter Exercises and Reviews●Section III: Answer Keys to Workbook Assignments and ReviewsSections II and III are organized according to chapter.Note:●Section IV: Answer Keys to Workbook Appendices A–D: Coding Patient RecordsAnswer Key to Appendix A: Coding Ambulatory Care Surgery Patient RecordsAnswer Key to Appendix B: Coding Emergency Department Patient RecordsAnswer Key to Appendix C: Coding Physician Office RecordsAnswer Key to Appendix D: Coding Hospital Inpatient Records●Section V: Answer Key to Workbook Appendix E: Mock Certified Professional Coder (CPC) CertificationExamination●Section VI: Answer Key to Workbook Appendix F: Mock Certification Coding Specialist-Physician (CCS-P)Certification Examination●Section VII: Answer Key to Workbook Appendix G: Mock Certified Coding Specialist (CCS) CertificationExaminationPrefacevConsider placing a sticky note as a tab at the beginning of each section in the’sManual.Teaching Tip:62679_fm_rev03.indd51/20/205:09 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 6 preview image

Loading page ...

viPrefaceSTudENTwORKbOOKThe workbook follows the chapter organization of the core textbook and contains application-based assignments.Each assignment contains a list of objectives, an overview of content relating to the assignment, and instructionsfor completing the assignment. The last assignment in each workbook chapter contains review questions inmultiple-choice format to emulate credentialing exam questions. The workbook also contains actual patientrecords and mock CPC, CCS-P, and CCS certification examinations.ENCOdERPRO.COm ExPERTEnhance your course with Cengage learning materials and an online coding tool from Optum360®.EncoderPro.com Expertis an online coding and reference tool designed to enhance your coding capabilities.●Using online coding tools can help by saving you time and money;●Increasing accuracy, reducing denials, and ensuring you receive complete reimbursement; and●Reducing required storage space and paper.Features of EncoderPro.com Expert include:●ICD-10-CM/PCS, HCPCS level II, and CPT code content search●ICD-10 mapping tools●Coders' Desk Reference●Complete code history●Local Coverage Determinations (LCDs) and Medicare Pub. 100 access●Medicare CCI edits●Modifier crosswalk●Enhanced compliance editor●Enhanced LCD/NCD policy searching●Cross-coder relationships from seven coding and billing specialty reference booksTo make the switch and start saving on coding materials with Cengage and Optum360®, contact your CengageLearning Consultant today at cengage.com/repfinder.INSTRuCTORCOmPANIONSITEAdditional resources can be found online athttp://login.cengage.com.Items listed asResources are password-protected. To access the protectedResources, go tohttp://login.cengage.comto create a unique single-user sign-on. Contact your sales representative for more information.Login instructions for Student Resources listed on the Student Companion Site are located inthe textbook Preface.Note:Theand Student Companion Sites also include files that contain updates tothe textbook and its supplements, which were changes made to the textbook, workbook,instructor’s manual, and/or computerized test bank after publication (e.g., revised codes due tocoding updates). You are welcome to email the author atmichelle.ann.green@gmail.comwithquestions or comments. The author will respond to your emails, and appropriate corrections willbe posted to provide clarification about the textbook and its supplements.Teaching Tip:62679_fm_rev03.indd61/20/205:09 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 7 preview image

Loading page ...

PrefaceviiINSTRuCTOR RESOuRCESIn addition to this electronic version of the’s Manual, theResources contain an onlinecomputerized testbank powered by Cognero, and instructor’s slides created in PowerPoint®. These supplementsare located at the password-protectedCompanion Site athttp://login.cengage.com.The Cognero testbank contains multiple choice and completion (coding) questions. Cognerosoftware is available on theCompanion Site to allow you to generate examsquickly, which can be printed, exported and uploaded to a learning management system(e.g., Blackboard), or web-enabled. This means that you can create different versions of thesame exam for large classes of students (when students cannot be separated from each otherby an empty desk). To save you some time, exported files for Blackboard, Moodle, Angel,Desire2Learn, and Canvas can be downloaded directly from theCompanion Site.Teaching Tip:62679_fm_rev03.indd71/20/205:09 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 8 preview image

Loading page ...

1Green’s3‐2‐1CodeIt!,2020ShortAnswer/DiscussionQuestionsANSWERKEYScenario11.Answerswillvary.JoanshouldbetoldthatsharingmedicalrecordsthatcontainpatientidentificationinformationisprohibitedbyHIPAA.2.Answerswillvary.Inthefuture,ifJoanwantstoshareamedicalrecordwiththeclass,sheshouldaskherprofessoraboutthecorrectprocessforsharingaredactedrecord(thatdoesnotcontainpersonalidentifierssuchaspatientandprovidernames,dateofbirth,socialsecuritynumber,etc.).3.Answerswillvary.Codingactualrecordsisdifferentfromcodingcasestudiesbecausecasestudieshavelimitedinformationavailableforcodingpractice.Actualrecordscontainallreportsneededtoassigncodes,sostudentsspendmuchmoretimereviewingreportstodeterminediagnosesandprocedurestowhichICD‐10‐CM/PCScodesareassigned.Scenario21.Answerswillvary.No,Matthewshouldnottellhismotherabouthissister'sdiagnosis,andheshouldalsonotcallhissisterabouttheinformationhehaslearned.Yes,thisisaHIPAAviolationthatwillresultinhisimmediateterminationfromhispositionandcouldresultincivilliabilityforthefacility.2.Answerswillvary.Matthew'sreviewingandcodinghissister'srecordisaHIPAAviolation.BecauseMatthewisanemployeeatthehospitalheneedstoabidebyallprivacyandsecuritylawsregardingpatientconfidentiality.Thatmeansassoonashenoticedthattherecordhewasreviewingwashisfamilymember's,heshouldhavenotifiedhissupervisorthattherecordshouldbereassignedtoanothercoder.Scenario31.Answerswillvary.Yes,Zoeshouldquerytheprovider.2.Answerswillvary.No,itisnotacceptableforZoetocodethepatientrecordevenifshebelievessheknowstheanswertoaquery.3.Answerswillvary.IfZoefailstoquerytheproviderandthesubmittedclaimisdeniedoraudited,thereisnowayofexplainingZoe'scodinglogicbecauseproviderdocumentationdoesnotsupportit.

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 9 preview image

Loading page ...

2Scenario41.Answerswillvary.Becausethesubmittedclaimreportedcodesforarightkneex‐ray,chestx‐ray,andEKG,andbecausechestpainwasnotreportedontheclaim,reimbursementfortheEKGandchestx‐rayweredenied.2.Answerswillvary.Angelashouldhavereportedacodeforthechestpainbecauseitdocumentedmedicalnecessityfortreatmentofthechestpain.Scenario51.Answerswillvary.ItwouldbehooveCattocontactthehealthinformationmanagement(HIM)department'smanagertoscheduleatimetointroduceherself.Ifthemanageristoobusy,Catcouldaskifshecouldcheckinwithherinafewweeks,andfollowthrough.NetworkingwiththeHIMdepartmentmanagermayeventuallyleadtoavolunteeringpositionoraclerkpositionwithinthedepartment.Oncethere,sheisinagoodpositiontomeetwiththecodersandcodingsupervisorforfurtherdirection.2.Answerswillvary.Catcanalsoregistertotakethecodingcertificationexam,properlypreparingforseveralmonthstohelpensurethatshepassestheexamthefirsttime.Catshouldalsojointhelocalandregionalassociationsandattendmeetingstobeginnetworkingwithindividuals(e.g.,coders)whowouldbeinapositiontoalertCataboutjobpossibilitiesandevenrecommendherforsuchpositionsonceshehasbecomecredentialed.Scenario61.Answerswillvary.Codingisadetail‐orientedprofessionthatrequiresknowledgeofanatomy,physiology,andpathophysiology.Theworkenvironmentmayincludeworkingwithelectronicpatientrecords,sittingforextendedperiodsoftime,aswellascommunicatingwithproviders.2.Answerswillvary.ContactingtheAmericanHealthInformationManagementAssociation(AHIMA)aswellastheAAPC(formerlycalledtheAmericanAssociationofProfessionalCoders)isanexcellentwaytofindmoreinformationontheprofession.3.Answerswillvary.Itcanbedifficulttofindacodingpositionatfirst,butonceanindividualiscredentialedandstartsnetworkingwithcodingprofessionalsbyattendingprofessionalassociationmeetingsandevents,opportunitiestoapplyforcodingpositionswillpresent.Scenario71.Answerswillvary.Whileitisunderstandabletobeupsetifaquestionwasmarkedincorrectly,Ellieshouldlettheteacherknowsoitcanbefixed.2.Answerswillvary.Ellie'simpatienceaboutcontactingtheteacherimmediatelywasunreasonable.EllieshouldhavewaiteduntilMondaytotalkwiththeteacherabouttheincorrectlymarkedexam.

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 10 preview image

Loading page ...

33.Answerswillvary.Theteachershouldreassuretheclassthatanymistakesmadeingradingwillbepromptlycorrected.TheteachershouldalsohaveaprivateconversationwithEllieaboutthewayshehandledthesituation,focusingonherimpatienceandcomplainingtootherstudents.Theteachercanexplainthatitisnotalwayspossibletoobtainimmediatefeedbackaboutaproblem,andthatthesetypesofsituationsalsooccurintheworkplace.ItisimportantthatEllielearntobepatientaboutresolvingproblemsandnotcomplaintoothersbecausethisonlyservestocauseunnecessaryconflict.Scenario81.Answerswillvary.First,MelissashouldtalkwithJamieinanattempttodeterminewhyJamieisaskingquestionsaboutbasiccodingrules.ItispossiblethatJamiefeelsinsecureaboutherlevelofcodingknowledgeandislookingtoMelissaforguidance.OnlyiftheconversationwithJamieresultsinunresolvedissuesshouldMelissatalkwithhersupervisor,Maria.IfMelissatalkswithMaria,thenMariashouldlistentoMelissa'sconcernstodetermineifthisisapersonalityconflictorsomethingelse.MariashouldalsotalkwithJamietoseehowshe'sgettingalonginthedepartmentandifshehasanyquestionsorconcerns.2.Answerswillvary.Onepossibleconflictresolutionwouldbetobringbothemployeestogetherintheofficetofindasolutiontotheissuesastheycomeup.3.Answerswillvary.ItisimportantthatMelissatalkwithJamie,andthenifnecessary,Mariasoonsothatconflictdoesnotescalate.Scenario91.Answerswillvary.Sendinganemailannouncingsuchchangeswasaninappropriatecommunicationmethod,andKeishaneedstoadmittoheremployeesthatsheusedpoorjudgmentindoingso.2.Answerswillvary.Themethodforintroducingchangeinadepartmentwouldbeformanagementtobetransparentwiththestaff.Thisinvolvesaface‐to‐facemeeting,notemail.3.Answerswillvary.KeishacouldapproachthemeetingbysharingwiththestafftheissuesofimplementationofthenewelectronichealthrecordandtherequirementfromseniorleadershipthatoneFTEbereduced.Then,Keishacanpresentthesolution,keepinginminditwilltaketimeforeventualacceptanceofchange.Employeesshouldbeallowedtoexpresstheirconcernsandsuggestionsregardingthechanges.PerhapsemployeeswillhaveideasforimplementationofthechangesthatKeishahadnotthoughtofpreviously.ItisimportantthatKeishamaintainanopen‐doorpolicywithherstaffsoanyonecangointotalkwithher,andsheshoulddowhatshecantokeepmoralehighintimeofchange.Scenario101.Answerswillvary.Studentsshouldbecomefamiliarwithwebsitessuchaswww.aapc.comandwww.ahima.org.Furthermore,theAAPCandAHIMAhaveinformationaboutcareerpathsandcertificationsrelatedtocodingandhealthinformationmanagement.

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 11 preview image

Loading page ...

42.Answerswillvaryandwillbeindividualizedbystudent.3.Answerswillvary.Anexampleofthreepossiblejobtitlesincludesreleaseofinformationtechnician,HIMsupervisor,privacyandcodingcomplianceofficer.Scenario111.Answerswillvary.Andycouldhaveavoidedthissituationentirelyifhehadbeencarefultofilepatientrecordsproperly.Heshouldhaveneverbeencarelessaboutaccuratefilingpractices.2.Answerswillvary.Whilethismaybeanextremeexampleofhownotfindingapatientrecordquicklycancauseadelayorcatastropheinpatientcare,itisalwaysimportanttoadheretodepartmentpolicyandproceduresregardingsharingandstoringpatientinformation.InAndy'scase,heneedstoinformhismanageraboutthesituation.Scenario121.Answerswillvary.Unfortunately,thereisnoeasysolutiontothisproblem.Asmanagersexpectmore,workingconditionscaneasilybecomestressful.OfsignificanceisthenumberofmeetingsNataliehaseachday;Nataliecouldreviewthemeetingssheattendsanddetermineifothersinherchainofcommandcouldparticipateinstead.Shecouldalsolookfor"duplication"bynoticingwhethermorethanoneemployeefromthehealthinformationmanagementdepartmentattendsmeetings,andthensuggesttohermanagerthatsheeliminatecertainmeetingsfromherdailyschedule.2.Answerswillvary.Nataliemightconsider"workingsmarter"bydelegatingtaskstohercoders,prioritizingprojectsinorderofimportance,determiningaschedulefortasks,andtakingadvantageofcalendarreminders.Insteadofbeinggluedtoheremailthroughouttheday,shemightwanttocarveouttimeattheendofthedaytorespondtoheremails.Scenario131.Answerswillvary.ThisisawonderfulopportunityforAngelatoshine!Inordertobenoticed,Angelashoulddressprofessionally,andbringcopiesofhercurrentresume.2.Answerswillvary.AsanexperiencedHIMmanager,itisimportanttoreachouttostudentslikeAngelaandshareanyadviceorencouragement.3.Answerswillvary.Angelacouldhavebusinesscardsavailabletohandouttoprospectiveemployersbecausethesecardscanbeanimportanttoolatanynetworkingevent.

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 12 preview image

Loading page ...

5Scenario141.Answerswillvary.Studentsshouldresearchmembershipbenefitsofbothorganization'swebsitestodeterminetheadvantagesineach.Theyshouldreviewrequirementsforentrylevelcodingexams.Studentsshouldalsodeterminewhichcredentialismostappropriatefortheirregionofthecountry.2.Answerswillvary.Forentry‐levelcoders,theAAPCofferstheCertifiedProfessionalCoder(CPC),andAHIMAofferstheCertifiedCodingAssociate(CCA).3.Answerswillvary.Studentscanmakealistcomparingthebenefitsofeachorganizationasanexcellentvisual,aswellasatopicforclassdiscussions.Scenario151.Answerswillvary.Ms.MshouldreachouttoDavidandseeifthereareanyresourcesshemightbeabletoprovide.Shecouldexpressconcernoverhiscourseloadandworkingfulltime.Shemightwanttoreferhimtothestudentcounselingdepartmentoncampuswhomightprovidehimwithtipstohelphimgetthroughthesemester.2.Answerswillvary.Davidshouldtakeastepbacktoweightheprosandconsofwhatheistryingtoaccomplishatthemoment‐anddetermineifit'sworthit.Woulditbeokaytodropafewhoursofworktoallowmorestudytime?Whatabouttakingsomedaysofffromworktohelpbalancetheworkload?Whileschoolisimportant,it'salsoimportantthatDavidstayshealthyinbodyandinmind.Scenario161.Answerswillvary.Melodyshouldprobablydomoreobservingofthedepartmentdynamicsandworkflowprocesses.Then,sheshouldscheduleaget‐to‐know‐youmeetingwitheachstaffmembertotalkone‐on‐oneregardingtheirjobs,theirgoals,andanyproblemstheywouldliketoseeresolved.2.Answerswillvary.Justbecausethereceptionistdidnotlikethecoder,doesn'tmeaneveryoneelsefeltthesameway.Melodyshouldhandlethesituationdelicately,butalsodetermineifthereareanyissuesshecouldaddress,orifthisisapersonalopinion.Ifthestaffdidnotlikethecoder,itcouldbebecausethecoderisshy.Shemaynotfeelcomfortableinherenvironment,orperhapssheisverytunedintocompletingherdailytaskswithaccuracyandspeed.Melodyshouldnottakesideswitheitherthecoderorthereceptionist,butrather,takeeveryone'sviewintoconsiderationwhenshemeetsone‐on‐one.3.Answerswillvary.Codersare,bynature,independentemployeeswhoenjoyworkingalone.That,alongwiththeneedtofocusonpatientrecorddocumentationwhenassigningcodes,whichimpactsreimbursementtotheclinic,canresultincodersbeingperceivedasnonsocial.However,iftheclinicsponsorsactivitiessuchasasummerpicnic,thatcreatesanopportunityforthecodertosocializewithotherclinicemployees.

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 13 preview image

Loading page ...

6Scenario171.Answerswillvary.DependingonthetypeofworkingrelationshipMandyhaswithSara,shecouldremindSaraabouttheimportanceofcurrentlaborders.Or,Mandycouldspeakwithherownmanageraboutthesituation.2.Answerswillvary.WhileMandycancodelabresultsfromtheexpiredlaborders,shewilltalktohermanagertoseehowtheyshouldbeprocessed.(Payerswilldenyreimbursementuponauditofclaimssubmissionsandpatientrecordsandtheexpiredlabrequisitionorders.)3.Answerswillvary.Thiserrorcouldbeavoidedbytheorganizationimplementingasystemofchecksandbalancestocatchexpiredorders.4.Answerswillvary.InadditiontoSaraconfirmingthelaborders,thelabtechcouldalsoconfirmthedateoftheorderspriortodrawinganyblood.Scenario181.Answerswillvary.Nicole'smanager,Vickie,mightvalidateNicole'sfearsandconcerns,butalsocoachNicoleonhowsheshouldpreparefortheexam.Thisshouldincluderesources,studygroups,andmaybea'buddy'partneratwork.2.Answerswillvary.ProfessionalassociationsandpublisherssuchasCengageLearningofferexcellentresourcesforcodingcertificationexampreparation.3.Answerswillvary.AsaclosefriendofNicole's,itisimportanttosupporthereffortstotaketheexamandremindherthisisalearningprocess!ShemightevenoffertohelpNicolestudy,oranswerspecificquestionsastheyarise.Scenario191.Answerswillvary.Thecoder'slaxattitudetowardaccurate,industry–specificcodingwillgether,andherfacility,intoalotoftrouble!2.Answerswillvary.Theco‐workershouldshare,inconfidence,thisinformationwiththecodingmanagerandletthecodingmanagertakecareoftheproblem.3.Answerswillvary.ThecodershouldrefrainfromcommentingonSamantha'sstatementandgodirectlytothecodingmanager.4.Answerswillvary.

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 14 preview image

Loading page ...

S E C T I O NS E C T I O NiPreparing Your Course62679_sec01_rev04.indd11/17/204:00 PMNot For Sale

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 15 preview image

Loading page ...

2SECTION I3-2-1Code It!is a comprehensive textbook that covers all coding systems, and its content is written toprepare medical assistants and other health care professionals for beginner or entry-level coding positions.ICD-10-CM and ICD-10-PCS coding are included in Chapters 2–7. (Chapter 6 is not typically covered byacademic programs that focus on outpatient and physician coding.) Chapter 1 includes an overview of coding,Chapter 8 includes HCPCS level II coding, Chapters 9–19 include CPT coding (with five chapters dedicatedto CPT Surgery coding), and Chapter 20 includes content about insurance and reimbursement. The textbookis organized so that content can be taught in parts in one course (Table 1) as well as in two (or more) courses.Your academic program and course requirements will determine the sections that should be taught to students.ExamplE1:A sequence of two-semester coding courses could include textbook Parts I and II in an ICD-10-CM and ICD-10-PCS coding course. Then textbook Parts III and IV could be taught in a HCPCS level II and CPT coding course. Many medicalassistant and coding programs also teach a separate insurance and reimbursement course, eliminating the need to requiretextbook Part V in either coding course. However, if your program does not have a separate course, consider adding textbookPart V to one of your coding courses (or to an entirelydifferent course, such as Introduction to Health Information Management).ExamplE2:A one-semester coding course taught in a medical assistant (MA) or medical office administration(MOA) program could include textbook Parts II, III, and IV, eliminating Chapter 5 from textbook Part II. You could alsoconsider eliminating Chapters 11, 18, and 19 from the course syllabus (and assigning them outside of class or offerthem as an independent study course).Many MA and MOA programs teach a separate insurance and reimbursement course, eliminating the need toinclude textbook Part V in the coding course. If the program does not offer a separate insurance and reimbursementcourse, consider adding textbook Part V content to a different course (e.g., Administrative Medical Assisting orIntroduction to Health Information Management).Table 1Organization of3-2-1 Code It!PartTitleChapterICoding OverviewChapter 1: Overview of CodingIIICD-10-CM and ICD-10-PCS Coding SystemsChapter 2: Introduction to ICD-10-CM and ICD-10-PCS CodingChapter 3: ICD-10-CM and ICD-10-PCS Coding ConventionsChapter 4:ICD-10-CM Chapter-Specific Coding Guidelines:ICD-10-CM Chapters 1–10Chapter 5:ICD-10-CM Chapter-Specific Coding Guidelines:ICD-10-CM Chapters 11–21Chapter 6: ICD-10-CM and ICD-10-PCS Hospital Inpatient CodingChapter 7: ICD-10-CM Outpatient and Physician Office CodingIIIHealth Care Procedure Coding System (HCPCS),Level II Coding SystemChapter 8: HCPCS Level II Coding SystemIVCurrent Procedural Terminology (CPT)Coding SystemChapter 9: Introduction to CPT CodingChapter 10: CPT Evaluation and ManagementChapter 11: CPT AnesthesiaChapter 12: CPT Surgery IChapter 13: CPT Surgery IIChapter 14: CPT Surgery IIIChapter 15: CPT Surgery IVChapter 16: CPT Surgery VChapter 17: CPT RadiologyChapter 18: CPT Pathology and LaboratoryChapter 19: CPT MedicineVInsurance and Reimbursement OverviewChapter 20: Insurance and ReimbursementN o t e :NOTE: Chapter 5 is not typically covered by academic programs that focus on outpatient and physician coding.62679_sec01_rev04.indd21/17/204:00 PM

Solution Manual For 3-2-1 Code It! 2020, 8th Edition - Page 16 preview image

Loading page ...

Preparing Your Course3SEMESTER PLANSThe one-semester plan (Table 2) assumes 45 hours of classroom lecture (or 3 hours per week for 15 weeks).Your course may also include an additional 45 hours of laboratory during the semester, for which correspondingworkbook chapters can be assigned. The final examination is not included in the 45-hour plan.Some educators prefer to use this textbook for a two-semester sequential course, teaching ICD-10-CM andICD-10-PCS in one course and HCPCS level II and CPT in another course. If that is the method you prefer, referto the two-semester plan (Table 3).Table 2One-Semester PlanWeekChapter1–2Chapter 1: Overview of CodingChapter 2: Introduction to ICD-10-CM and ICD-10-PCS CodingExam 13–4Chapter 3: ICD-10-CM and ICD-10-PCS Coding ConventionsChapter 4: ICD-10-CM Chapter-Specific Coding Guidelines : ICD-10-CM Chapters 1–10Chapter 5: ICD-10-CM Chapter-Specific Coding Guidelines: ICD-10-CM Chapters 11–21Exam 25–6Chapter 6: ICD-10-CM and ICD-10-PCS Hospital Inpatient CodingChapter 7: ICD-10-CM Outpatient and Physician Office CodingExam 3NOTE:If teaching in a medical assistant or medical office administration program, consider eliminating Chapter 6, whichcovers hospital inpatient coding.7Chapter 8: HCPCS Level II Coding SystemExam 48Chapter 9: Introduction to CPT CodingChapter 11: CPT AnesthesiaExam 5NOTE:If teaching in a medical assistant or medical office administration program, consider requiring Chapter 11: CPTAnesthesia as an outside-of-class assignment.9Chapter 10: CPT Evaluation and ManagementExam 610–12Chapters 12–16: CPT Surgery I–VExam 7NOTE:If teaching in a medical assistant or medical office administration program, consider covering just those portions ofChapters 12–16: CPT Surgery I–V that pertain to your academic program’s community of interest. A community of interestincludes employers who hire an academic program’s graduates; the employers should be surveyed to determine thelevel of CPT Surgery coding required of graduates. For example, medical assistants might be required to assign codes forsimple and intermediate repairs in the CPT Integumentary subsection (but not for skin grafts and flaps, which are oftenperformed in a hospital ambulatory surgery or inpatient setting and coded by hospital outpatient and inpatient codingspecialists).13–14Chapter 17: CPT RadiologyChapter 18: CPT Pathology and LaboratoryChapter 19: CPT MedicineChapter 20: Insurance and ReimbursementExam 8Finals WeekComprehensive Final Examination (Chapters 1–20)62679_sec01_rev04.indd31/17/204:00 PM

Preview Mode

This document has 274 pages. Sign in to access the full document!

Report

Study Now!

Document Details

Related Documents

Reflective and Applied Statement

PHR Exploration Worksheet

Discussion 5 Life and Death

UHDDS in Healthcare Information Management Week 8

Healthcare Access and Outcomes U

The Impact of Social Determinants of Health Discus

Wk 3 Discussion Different Types of Insurance

Policy Proposal Verde Valley Medical Center

Essential Guide to Hemodynamic Monitoring in Criti

Usability and Information design for Electronic he

Company

Explore

Study Tools