2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions)

Page 1 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 1 preview image

ATI MED SURG TEST BANK2023VERIFIED1.A nurse is preparing to administera blood transfusion to a client who has anemia. Whichofthefollowingactions shouldthenursetakefirst?checkforthe typeandnumberofunitsofblood toadminister2.a nurse is providing teaching to an older adult female client who has stress incontinenceandaBMIof32.Whichofthefollowingstatementsbytheclientindicatesanunderstandingof theteaching?Iam dietingtolose weight3.Anurseisprovidinginstructionstoaclientwhohastype2diabetesandanewprescription of metformin. Which of the following statements by the client indicates anunderstandingof theteaching?Ishouldtakethismedicationwithameal4.a nurse is providing teaching to aclient who has chronic kidney disease and a newprescription for erythropoietin. Which of the following statements by the client indicatesan understanding iftheteaching?iamtakingthismedicationtoincreasemyenergylevel5.anurseiscaringforaclientwhohasaprescriptionforenalapril.Thenurseshouldidentify which of the following findings as an adverse effect of the medication?orthostatic hypotension6.anurseiscaringforaclientwhohashypothyroidism.whichofthefollowingmanifestationsshould thenurseexpect?constipation7.a charge nurse is instructing a newly licensed nurse about caring for a client who hasMRSA. which of the following statements by the new nurse indicates an understanding ofthe teaching?iwillleaveassessmentequipmentinthe roomto useonthispatient8.anurseisprovidingteachingtoaclientwhohasirritablebowelsyndrome(IBS).whichofthefollowing instructions should thenurseincludein theteaching?increasefiberintaketoatleast30g/day9.anurseiscaringforaclientwhohasapositivecultureforc.diff.whichofthefollowingactionsshould thenursetake?implementcontactprecautionsfortheclient10.anurseiscaringforaclientwhohasanewdiagnosisofhyperthyroidism.whichofthefollowingisthe priorityassessment findingthatthe nurseshould reportto theprovider?BP170/8011.anurseisplanningcareforaclientwhoisscheduledforathroacentesis.whichofthefollowing interventions should thenurseincludein theplan?encouragetheclienttotakedeepbreaths aftertheprocedure12.anurseisassessingaclientwhohashadasuspectedcerebrovascularaccident.thenurseshouldplacethepriorityonwhich of thefollowingfindings?dysphagia

Page 2 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 2 preview image

Page 3 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 3 preview image

13.a nurse is reviewing the ABG results of a client who has advanced COPD. which of thefollowing results should thenurseexpect?PaCO25614.a nurse is providing discharge instructions to a client who has laryngeal cancer and isreceiving radiation treatment.which of the following statements by the client indicates anunderstandingof theteaching?i willavoid directexposureto thesun15.a nurse is assessing for compartment syndrome in a client who has a short leg cast. whichofthe following findingsshouldthenurseidentify asamanifestation ofthiscondition?painthatincreaseswithpassivemovement16.a nurse is providing teaching to a client who has a gastric ulcer a d a new prescription foromeprazole. the nurse should instruct the client that the medication provides relief bywhich of thefollowingactions.suppressinggastricacidproduction17.a nurse is assessing a client who has peripheral arterial disease. which of the followingfindingsshouldthenurseexpect?hairlossonthelowerlegs18.a nurse is assessing a client following the completion of hemodialysis. which of thefollowing findings isthenurse's priorityto reporttotheprovider?restlessness19.anurseisreviewingthemedicalrecordofaclientwhohasosteomyelitisandaprescription of gentamicin. which of the following findings from the client's medicalrecord shouldindicate to thenursetheneed to withhold themed?serumcreatinine20.a nurse is reviewing the medical record of a client who has SLE. which of the followingfindingsshouldthenurseexpect?facialbutterflyrash21.anurseisprovidingteachingtoaclientwhohasanewprescriptionforpsyllium.whichofthefollowing information shouldthenurse includeintheteaching?drink240mLofwaterafteradministration22.a nurse in a provider's office is assessing a client who has migraine headaches and istaking feverfew to prevent her headaches. the nurse should identify that which of thefollowing clientmeds interacts with feverfew?naproxen23.anurseinaprovider'sofficeiscaringforaclientwhorequestssildenafiltotreaterectiledysfunction. whichofthefollowingstatements should thenursemake?youwill notbe ableto usesildenfil ifyouaretakingnitroglycerin24.a nurse is caring for a client who is receiving TPN. a new bag is not available when thecurrent infusion is nearly completed. which of the following actions should the nursetake?administerdextrose10%inwateruntilthe newbagarrives25.a nurse is providing discharge teaching to a client who has HF and a new prescription fora potassium-sparing diuretic. which of the following information should the nurse includein theteaching?trytowalkat least3times perweekforexercise

Page 4 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 4 preview image

26.a nurse is planning care for a client who is postop following a laparotomy and has aclosed-suction drain. which of the following actions should the nurse take to manage thedrain?compressthedrainreservoirafteremptying27.a nurse in an emergency department is admitting a client who reports dyspnea and SOB.whichofthefollowingactionsisthepriorityforthenursetoperformpriortoadministeringoxygen?determineifthe clienthasa historyofCOPD28.a nurse is obtaining a med history from a client who is scheduled to undergo cataractsurgery.thenurseshouldrecognizethatwhichofthefollowingclientmedsisacontraindication for thesurgeryandnotify the provider?warfarin29.anurseiscaringforaclientfollowingextubationofherendotrachealtube10minago.whichofthefollowing findingsshouldthe nurse reportto theprovider immediatelystridor30.a nurse is providing dietary teaching to a client who is postop following a thyroidectomywith removal of the parathyroid glands. the nurse should instruct the client to includewhich of thefollowing foods toincrease calciuminthediet?12almonds31.a nurse is preparing to assist with the insertion of a nontunneled percutaneous centralvenous catheter into a subclavian vein. the nurse should plan to place the client in whichofthefollowingpositions?trendelenburg32.teachingtoclientwithHTNandnewmedverapamil.whatjuiceshouldclientavoid?grapefruit33.clientexperiencinganaphylacticreaction,afterpatentairway,whichisprioritynursingintervention?apply oxygenvifacemask34.clienthadnephrostomytubeinserted12hrsago.whatshouldthenursereporttotheprovider?clientreportsbackpain35.teachingtoperimenopausalandhashormonereplacementtherapy.adverseeffectstonotify provider?calfpain,numbnessinarms,andintenseheadache36.olderadultwithcancerandanewprescriptionofopioidanalgesic.whichinfoshouldthenurseincludeinteaching?youshouldincreaseyourfiberintaketopreventconstipation37.anurseisprovidingmedteachingtoagroupwithseizuredisorders.instructionaboutphenytoin?phenytoindecreasestheeffectivenessoforalcontraceptives38.anurseiscaringforclientwithsupraventriculartachycardia.whichactionshouldnursetakenext?performsynchronizedcardioversion39.changeofshiftreport withfourclients.client withgreatestriskofdevelopinginfection?COPDandreceiving steroidtherapy40.teachwithselfadministrationofheparin?

Page 5 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 5 preview image

useelectricrazor41.client having seizure, nurse priority?turn clienton theside42.FemaleclientwithhxofUTI,nurseincludeinteaching?cleanperineum fronttoback43.cardiac assessment with MI 2 days ago. action after hearing this sound?listenwithclienton leftside44.clientonbedrestandenoxaparinsubcut,actionsnursetake?administer med atthe sametimeeach day45.postopfollowingparathyroidectomy.priorityaction?placeatrach tray atbedside46.ptwitharterialline,followingactionsshouldnursetaking?placeapressurebag around theflush solution47.teachingclientaboutafibandpurposeofwearingaholtermonitor.infoshouldnurseincludeintheteaching?this devicecandetectwhenyouhaveanirregularHR48.client with DKA, client condition improving?glucose 27249.stroke on right hemisphere. nurse expect?impulsive behavior50.clientwhohasexternalfixationdeviceforfracture.instructionfornurseplan ofcare?usecrutches with rubbertips51.receiving mechanicalventilationviatrachtube. nurserecognizescomplicationswithlongtermmechanicalventilation?stressulcers52.teachingaboutasthmauseofmetered-doseinhaler.understandteaching?holding breathfor 10 secs afterinhaling53.gravesdisease,picturewithexophthalmos?big eyes, lastpicture54.legcastanddemonstrationw/crutchesonclimbingstairs.identifystepsbodyweightoncrutches,advanceunaffectedlegontostair,shiftweightfromcrutchtounaffected,bringcrutchesand affectedleg up to thestair55.olderadultwithfracturedwristfollowingfall.lastweekicrashedmycarbcmyvisionsuddenly blurry.checkforneurostatus56.peformingdressingchangerecoveringfromhemicolectomy.largepartofbowelisprotruding, action takefirst?callfor help57.olderadultaboutosteoporosisprevention.medsincreaseriskfordevelopingosteoporosis?fludrocortisone58.client having modified radical mastectomy of rightbreast. intervention for plan of care?instructtheclientthatthedrainisremovedwhenthereis25mLofoutputorlessovera24hrperiod

Page 6 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 6 preview image

59.clientwithanemiaandaprescriptionforanoralironsupplement.whichofthefollowingstatementsby teaching?iwilleatmore highfiber foods60.programaboutpreventionofatherosclerosisathealthfair.recommendationsplantoinclude?followsmokingcessation,maintainappropriateweight,eatlowfatdiet61.TPN2000kcalperday.500kcal/L;mL/hr16762.client with chronic glomerulonephritis with oliguria. manifestation?hyperkalemia63.reviewinglabresultswithaplasticanemia.potentialcomplication?WBC 2,000/mm364.EDwithfullthicknessburnsover20%oftotalbodysurface.administerfirstafterpatentairway and administerO2?IVfluids65.clientwithUTIandprescriptionciprofloxacin.instructions?avoidtaking magnesium containingantacidswiththismed66.teachingwithAIDS. understandingof teaching?i willtakemy temp onceaday67.compoundfracture3weeksago,unexpectedfindinglabvalueofmanifestationofosteomyelitisand reportto provider?sedimentationrate68.bilateralpneumonia,clientisdyspneicwithproductivecough.actionnursetakefirst?placetheclientinhigh-fowlers position69.clientwhoishypokalemia.manifestations?decreasedperistalsis70.clientwithsuctioningtheclientstrachtube.indicationforhypoxia?the clients HRincreases71.medhxwhoundergoallergytesting.nurseshoulddiscontinuewhichmedbeforetesting?prednisone72.clientwithtype1DMandnewprescriptionforinsulinlispro.understands teaching?i willneed to take thelisproin additiontomyotherprescribedinsulin.73.clientpostoptotalhiparthroplasty.labvalueshouldnursereport?hgb 8g/dL74.checkingECGrhythmstripforclienthastemppacemaker.spikefollowedbyQRScomplex.Action takefirst?documentthedepolarizationhasoccured75.EDclientreportsvomitinganddiarrheapast3days.findingsclientexperiencefluidvolumedeficit?HR110/min76.PACUnurseclientpostoprightnephrectomy.VSchangesalertnurseclientmightbehemorrhaging?HR110/min77.ED planning care for flail chest on right side in motor vehicle crash. action plan to take?preparetheclientfor positivepressureventiliation78.providingdischargewpatientwithactiveTB,nurseteach?

Page 7 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 7 preview image

sputumspecimensare necessaryevery2-4wksuntilthere arethreenegcultures79.clientwhois12hrpostopfollowingtotalhiparthroplasty.actionnursetake?placeapillow between theclient'slegs80.reviewing lab results w client has acute leukemia. expected finding?increasedWBCcount81.clienthasvenousinsufficiencyaboutself-care.clientunderstandsteaching?i willwearcleangraduated compression stockingseveryday82.clienthasendstagekidneydiseaseaboutorgandonation.nurseincludeinteaching?theclientwhoreceivesakidney fromalivedonorhasa lowerrate oftransplant rejection83.clientisexhibitingmanifestationsofafebrilereactionwhilereceivingbloodtransfusion.medsshouldnurseadminister?acetaminophen84.clientreceivingplasmapheresisthroughvenousaccesssite.actionnursetake?checkelectrolytelevels beforeandaftertherapy85.clientatclientfora1weekfollow upvisitafterHF.nursereporttoprovider?HR55/min86.preopteachingforclientwithscheduledforopencholecystectomy,actionnursetake?demonstrate ways todeep breatheand cough87.acutecarefacilitycaringforclientatriskforseizures.precautionsnurseimplement?ensurethattheclienthas apatentIV88.clienthasbladdercancerandundergocutaneousdiversionproceduretoestablishureterstomy. nurseinclude in teaching?cuttheopeningofthe skinbarrier1/8inchwider thanthe stoma89.assessingmaleclientforinguinalhernia.whichareashouldthenursepalpatetoverifyhasinguinalhernia?C90.clientis8hrpostoptotalhiparthroplasty,clientunabletovoidonbedpan.actionnursetakefirst?scanbladderwithportableultrasoundSet 21.Anurseisreviewingthemedicalrecord ofaclient whohassystemiclupuserythematosus.Whichofthe followingfindings should thenurseexpect?Facialbutterfly rash.R:AbutterflyrashisamanifestationofSLE.Itappearsasadryredrashontheclientscheeksand noseandcan disappear during times of remission.2.A nurse is caring for a clientwho is receiving plasmapheresis through a venous accesssite.Whichofthefollowingactionsshouldthenursetake?Checkelectrolytelevelsbeforeandaftertherapy.R:Plasmapheresiscancausecitrateinducedhypocalcemia.Thereforethenurseshouldmonitorthe clients electrolytelevels before and after therapy.

Page 8 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 8 preview image

3.A nurse is assessing a clientwho has Graves disease. Which of the following imagesshouldindicateto the nursethattheclient has exophthalmos?The nurse should identify an outward protrusion of the eyes is exophthalmos a common findingof graves disease. An overproduction of the thyroid hormone causes edema of the extraocularmuscle and increases fatty tissue behind the eye which results in the eyes protruding outward.Exophthalmos can cause the client to experience problems with vision including focusing onobjectsas wellas pressureon the opticnerve.4.A nurse is performing a cardiacassessment for a client who had a myocardial infarction 2days ago. Which of the following actions should the nurse take first after hearing thefollowing sound?Listenwith theclient onhisleftside.Whenprovidingnursing carethenurseshouldfirstusetheleast invasive intervention. Therefore after auscultating a murmur the first action the nurseshouldtakeisto place theclient on hisleftsideand listen to hisheartagain.5.A nurse is providing teaching toan older adult female client who has stress incontinenceand a BMI of 32. Which of the following statements by the client indicates anunderstandingof theteaching questionmarkI am dieting to lose weight. Excess weight cut creates increased abdominal pressure that canresult in stress incontinence.6.A nurse is reviewing the ABG resultsof a client who has advanced COPD. Which of thefollowing results should thenurseexpect?Paco2of56.AclientwhohasCOPDretainspaco2due totheweakeningand thecollapseofthealveolar sacs which decreases the area and lungs for gas exchange and causes the paco2 toincreaseabovetheexpectedreferencerange.7.A nurse is providing teachingto a client who is perimenopausal and has a prescription forhormone replacement therapy. For which of the following adverse effects should thenurseinstructthe clientto notify the provider? Select all thatapply.Calfpain,numbnessin thearms andintense headache.CalfpainisanindicationofDVTandtheclient should report this finding to the provider immediately. Numbness in the arms can indicatecerebrovascular accident which is an adverse effect of hormone replacement therapy and anintenseheadachecanindicateacerebrovascular accident.8.A nurse isproviding teaching to a client who has chronic kidney disease and a newprescriptionforerythropoietin.Whichofthefollowingstatementsbytheclientindicatesan understanding of theteaching?Iamtakingthismedicationtoincreasemyenergylevel.Thegoaloferythropoietintherapyistoincrease the level of hematocrit and clients who have anemia. When the medication is effectivethe clientshouldhave adecreasingfatigueandanimprovement andactivity tolerance.9.A nurse is teaching a client who hasvenous insufficiency about self-care. Which of thefollowingstatementsshouldthenurseidentifyasanindicationthattheclientunderstandsteaching?Iwillwearcleangraduatedcompressionstockingseveryday.Theclientshouldapplyacleanpairof graduated compression stockings each day and clean soiled stockings with mild detergent andwarm water by hand.10.A nurse is preparing to present a program aboutatherosclerosis at a health fair. Which ofthefollowingrecommendationsshouldthenurseplantoinclude?Selectallthatapply.Follow a smoking cessation program maintain an appropriate weight eat a low-fat diet andincreasefluidintake.SmokingcessationisanimportantlifestylemodificationtopreventArthur

Page 9 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 9 preview image

sclerosis and preventing obesity through diet and exercise can help prevent atherosclerosis.Eating alowfatdietdecreasesLDLcholesteroland can prevent atherosclerosis.11.Anurseiscaringforaclient whois12hourspost-operative followingatotal hiparthroplasty.Whichofthe following actionsshouldthenursetake?Placeapillowbetweentheclients legs.Thenurseshouldplaceapillowbetween theclients legsto preventhipdislocation.12.A nurse is reviewing the medication historyof a client who is to undergo allergy testing.The nurse should instruct the client to discontinue which of the following medicationsbefore thetesting?13.A nurse is preparing to administera blood transfusion to a client who has anemia. Whichofthefollowingactions shouldthenursetakefirst?Check for the type and number of units of blood to administer. According to evidence basedpractice the nurse should first confirm that the type and number of units of blood to administermatcheswhat is indicatedin theclientsmedicationadministration record.14.Anurseisproviding teachingto aclientwhohasanemiaandanewprescriptionforanoral iron supplement. Which of the following statements by the client indicates anunderstandingof theteaching?Iwilleat morehigh-fiberfoods.Theclientshouldeathigh-fiber foodsto helppreventconstipation whichisacommonadverse effect of oralironsupplements.15.Anurse iscaringfora clientwhoispost-operativefollowinga totalhip arthroplasty.Whichofthe followinglaboratory valuesshouldthe nurse reporttotheprovider?HGBof8.Thenurseryreport andHGBlevelof8which isbelowtheexpected reference rangeand as anindicatorof postoperativehemorrhageoranemia.16.Anurseiscaringforaclient whohasa legcastandisreturning demonstrationontheproper use of crutches while climbing stairs. Identify the sequence the client shouldfollowwhendemonstrating crutchuse.Placebodyweight onthecrutchesAdvance theunaffected legonto thestair shiftweight fromthecrutchestotheunaffectedleg andthen bringthecrutchesandtheaffectedleg uptothe stair17.Anurseiscaringforaclient whoisonbed restandhasanewprescriptionforenoxaparinsubcutaneous.Which ofthefollowingactionsshould thenursetake?Administerthemedicationatthesametimeeachday.Thenurseadministerthemedicationtotheclient atthe sametime each daytomaintainconsistent serumlevels18.A nurse is reviewing the laboratoryresults of a client who has aplastic anemia. Which ofthe followingfindings indicatesapotentialcomplication?Whitebloodcell countof2000.Thiswhitebloodcellcountisbelow theexpectedreferencerange and indicates ariskfor severeimmunosuppression.19.A nurse in an emergency department is admitting a client who reports dyspnea andshortnessofbreath.Whichofthe followingactionsisthepriorityforthenurse toperformprior to administeringoxygen?Determineif the client has a history of COPD. According to evidence based practice the nurseshouldfirstassessiftheclienthasCOPD.Administeringoxygencanworsenchronichypercarbiain aclientwho has COPD20.A nurse in a provider's office is caringfor a client who requests sildenafil to treat erectiledysfunction.Which of thefollowingstatementsshouldthenurse make?

Page 10 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 10 preview image

You will not be able to use sildenafil if you are taking nitroglycerin. The client should not usesildenafil when taking nitroglycerin because both medications can cause vasodilation and lead tosignificant hypotension21.A nurse is in a provider's officeis providing teaching to a client who has a urinary tractinfection and a new prescription for ciprofloxacin. Which of the following instructionsshouldthenurseincludeAvoidtakingmagnesiumcontainingantacidswiththismedication.Thenurseshouldinstructtheclient to take Ciprofloxacin either two hours before or 6 hours after taking an antacid but not totake Ciprofloxacin with an antacid because magnesium containing antacids decrease theabsorption of Ciprofloxacin22.A nurse is providing follow-upcare for a client who sustained a compound fracture threeweeks ago. The nurse should recognize that an unexpected finding for which of thefollowing laboratory values is a manifestation of osteomyelitis and should be reported tothe providerSedimentationrate.Andincreasedsedimentationrateoccurswhena clienthasanytypeofinflammatoryprocess such as osteomyelitis23.Anurseiscaringforaclient whohashypothyroidism.Whichofthe followingmanifestationsshould thenurseexpectConstipation.Aclientwhohashypothyroidismcanexperienceconstipation duetothe decreasein the client's metabolism resulting and slow motility of the gastrointestinal tract. The nurseshouldinstructtheclientto increasefiberandfluidandtaketoreducethe riskofconstipation24.A nurse at an urgent care clinicis caring for a client who is experiencing an anaphylacticreaction. After ensuring a patentAirway which of the following interventions is thepriorityapplying oxygen via face mask because the priority intervention is for the nurse to apply oxygenusingahigh-flow non-rebreathermask todeliver oxygen at 90 to 100%WherewouldyoupalpatetoassessforaninguinalherniaThe nurse should palpate at the right groin area because an inguinal hernia forms of theperitoneumwhichcontainspartoftheintestine andcanprotrudeinto thescrotum inmales25.A nurse is checking the ECG Rhythmstrip for a client who has a temporary pacemakerthenursenotesaspikeorapacemakerartifactfollowedbyaQRScomplex.Whichofthefollowing actions shouldthenursetakeDocumentthatdepolarizationhasoccurred.Whena pacingstimulusisdeliveredtoTheventriclea spike appears on the ECG Rhythm strip this bike should be followed by a QRS complex whichindicatespacemaker captureor depolarization26.A nurse is caring fora client who is eight hours post-operative following a total hiparthroplastytheclientisunabletovoidonthebedpanWhichofthefollowingactionsshouldthenursetakefirstScan the bladder with a portable ultrasound the first action should be using the nursing processwhich is assisting the client scanning the bladder with a portable ultrasound device willdeterminetheamountof urinein thebladder27.A nurse is caring for aclient who is receiving tpn a new bag is not available when thecurrentinfusionisnearlycompletedwhichofthefollowingactionsshouldthenursetakeAdminister dextrose 10% in water until the new bag arrives. Tpn Solutions have a highconcentrationofdextrose thereforeifat-pnsolutionistemporarilyunavailablethenurse

Page 11 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 11 preview image

administer dextrose 10% or 20% and water to avoid a precipitous drop in the client's bloodglucose level28.A nurse is providing teaching to a client who has a gastric ulcer and a new prescriptionforOmeprazole.ThenurseshouldinstructtheclientthatthemedicationprovidesReliefbywhichof thefollowingactionsSuppressing gastric acid production. I loveher soul is a proton pump inhibitor it relievesmanifestationsofgastriculcersby suppressinggastric acidproduction29.A nurse is providing discharge teachingto a client who is to self administer heparinsubcutaneously. Which of the following responses by the client indicates anunderstandingof theteachingI will use an electric razor to shave. Heparin is an anticoagulant that places the client at risk forbleeding therefore the nurse should instruct theclient to use an electric razor when shaving toreducetherisk of cuts to theskin30.a nurse is caring for a client following excavation of her endotracheal tube 10 minutesago.Whichofthe followingfindingsshould thenursereporttotheproviderimmediatelyStrider. Using the Urgent vs. Non-urgent approach to client care the nurse should determine thatthe priority finding a Strider. Strider can indicate and narrowing Airway or possible obstructioncaused by edema or laryngeal spasms the nurse should report the finding immediately Implementan intervention31.anurseiscaringfora clientwhohadanephrostomytubeinserted12hoursago.Which ofthe followingfindings should thenursereportto the providerThe client reports back pain the nurse should notify the provider if the client reports back painwhich can indicate thatthenephrostomy tubeisdislodged or clogged32.A nurse is assessing a client whilesuctioning the clients tracheostomy tube which of thefollowingfindingsshouldindicatetothe nursethattheclient isexperiencinghypoxiaThe clients heart rate increases because hypoxia related to suctioning can cause the clients heartrate to increase if this occurs the nurse should discontinue the sectioning and immediatelyoxygenate the client with 100% oxygen the nurse should instruct the client to take three or fourdeep breaths priortosuctioningto reducethe risk for hypoxia33.A nurse is planning teaching fora client who has bladder cancer and isto undergo acutaneousdiversionproceduretoestablishandureterostomy.WhichofthefollowingstatementsshouldthenurseincludeintheteachingCut the opening of The Skin Barrier one eighth of an inch wider than the stoma. The clientshouldcuttheopeningofTheSkinBarrier1/8inchwiderthanthe stomatominimizeirritationoftheskin fromexposuretourine34.Anurseisteaching aclientwhohasatrialfibrillation aboutthe purposeofwearingaHolter monitor. Which of the following information should the nurse include in theteachingThis device can detect when you have an irregular heart rate because it reports and transmitselectrical impulses of the heart and alerts the nurse to dysrhythmiasmyocardial injury orconduction defects a Holter monitor allows the client freedom of movement while cardiacactivityis recorded35.A nurse is providing discharge teaching to a client who has heart failure and a newprescription for potassium sparing diuretic which of the following information should thenurseincludeintheteaching

Page 12 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 12 preview image

Trytowalkatleast3timesperweekforexercisebecausethedevelopmentofaregularexerciseroutinecanimproveoutcomesinclients whohaveheartfailure36.A nurse is caring for a clientwho has chronic glomerulonephritis with oliguria which ofthe following findings should the nurse identify as a manifestation of chronicglomerulonephritisHyperkalemia as a result of kidney failure because kidney failure results in decreased excretionofpotassium37.A nurses in an acute care facilityis caring for a client who is at risk for seizures which ofthe followingprecautionsshould thenurseimplementEnsurethattheclienthasa patentIVintheeventthatthe clientrequiresmedicationtostopseizureactivity38.A nurse is caring for a client who has bilateral pneumonia and an spo2 of 88% the clientis dyspneic and productive cough and is using accessory muscles to breathe which of thefollowing actions shouldthenursetakefirstPlacethe clientin ahighFowler'sposition39.Anurseiscaringforaclient whohasa newdiagnosisofhyperthyroidismwhichofthefollowingisthepriorityassessmentfindingthatthenurseshouldreporttotheproviderBlood pressure of 170 over 80 because using the Urgent vs. Non-urgent approach to client carethe nurse determines that the priority funding is a systolic blood pressure of 170 which indicatesthattheclientis atrisk for thyroidstorm40.A nurse is reviewing the medication historyof a client who is to undergo allergy testingthe nurse should instruct the client to discontinue which of the following medicationsbefore testingPrednisone because it is a glucocorticoid that can cause the client to have falsenegative testresults theyshoulddiscontinueantihistamine medicationsseveralweekspriortotesting41.A nurse is caring for a clientwho has an arterial line. Which of the following actionsshouldthenursetake?Placeapressurebagaround theflushsolution.Thenurseshouldplacea pressurebag aroundtheflushsolution becausethepressurefromanarteryis greater than thatof the line42.A nurse is caring for a client who has a new prescription for tpn the client is to receive2,000kcaloriesperdaythet-pnsolutionhas500kcaloriesper literthe IVpumpshouldbe setathow manymilliliters per hour167millilitersperhour43.A nurse is providing teachingto a client who has AIDS which of the following statementsbytheclientindicates anunderstandingof theteachingIwilltake mytemperatureonceadayaclientwhohasAIDSisimmunocompromisedandisatrisk for infection the client should take his temperature daily to identify a temperature greaterthan 100 degreeswhichis anearlymanifestationofan infection44.A nurse is assessing a client whohas peripheral artery disease which of the followingfindingsshouldthenurseexpectHair loss on the lower legs the nurse should expect a client who is Peripheral arterial disease tohave hair loss on the lower legs as a result of impaired arterial circulation affecting folliculargrowth45.A nurse is providing teaching to an older adult client who has cancer and a newprescriptionforanopioidanalgesicforpainmanagementwhichofthefollowinginformation should thenurseinclude in theteaching

Page 13 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 13 preview image

Youshouldincreaseyourfiberintaketopreventconstipationbecauseopioidsslowparacelsusinthe gastrointestinaltractwhich causesconstipation46.A nurse is planning care fora client who is scheduled for a thoracentesis which of thefollowing interventions should thenurseincludein theplanEncouragetheclienttotakedeepbreaths aftertheproceduretoreadexpandthe lungA nurse is caring for a clientwho has a prescription for Enalapril the nurse should identify whichofthefollowingfindingsas an adverseeffectof themedicationOrthostatichypotensionbecausedilationofarteriesandveinscausesorthostatichypotensionwhich is an adverseeffectof Enalapril47.A charge nurse is instructing a newlylicensed nurse about caring for a client who hasMRSA which of the following statementsby the newly licensed nurse indicates anunderstandingof theteachingI will leave assessment equipment in the room to use on this client the nurse should followcontactprecautionsandusededicatedequipmentwhenassessingtheclienttopreventcross-contamination with otherclients48.Anurseiscaringforaclient whorecently hadastroke oftheright hemisphere whichofthe followingmanifestations should the nurseexpectImpulsivebehavior49.A nurse is caring for a clientwho is exhibiting manifestations of a febrile reaction whilereceiving a blood transfusion which of the following medications should the nurseadministerAcetaminophen to reduce fever and decreased the manifestation of the febrile reactionmanifestationsofafebrilereactionincludetachycardiafeverhypotensionandchillsthenurseshoulddiscontinuethetransfusionand returnthebloodbagand tubingtotheblood bank50.A nurse is assessing a clientwho has hypokalemia which of the following manifestationsshouldthenurseexpectDecreasedperistalsisduetoadecreaseingastrointestinalsmoothmusclecontractionanurseiscaringforaclientwhoisexperiencingsupraventriculartachycardiauponassessingtheclient the nurse observes the following findings heart rate 200 per minute blood pressure 78 over40 and respiratory rate 30 per minute which of the following actions should the nurse takePerform synchronized cardioversion51.A nurse is providing dietary teaching to a client who is post-operative following athyroidectomy with removal of the parathyroid glands the nurse should instruct the clientto include which of the following foods that has the greatest amount of calcium in herdiet12 almonds because they are the best source of calcium to recommend because they contain 36milligramsofcalciumremovaloftheparathyroidglandswhichregulatecalcium inthebodycanresult in hypocalcemia52.Anurseiscaringforaclient whohasdka which ofthefollowingfindingsshouldindicateto thenurseattheclient's conditionis improvingGlucose of 272 because a glucose reading less than 300 indicates Improvement in the client'sstatus53.A nurse is performing a dressing change for a client who is recovering from ahemicolectomy when removing the dressing with the nurse notes that a large part of thebowel is protruding through the abdomen which of the following actions should the nursetakefirst

Page 14 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 14 preview image

Callforhelpbecauseevidencebasedpracticeindicatesthatthenurseshouldfirststaywiththeclient and call for assistance the client will require emergency surgery and is at risk for shockthereforethenurseshould attainimmediateassistance54.Anurseiscaringforaclient whopresentstoaclinicforaone-weekfollow-upvisitafterhospitalization for heart failure based on the information in the clients chart which of thefollowing findings should thenursereporttotheproviderHeart rate of 55 per minute is a significant drop from the clients Baseline of 74 permanent and itcan indicatethedevelopmentof digoxin toxicity55.A nurse is assessing for compartmentsyndrome ina client who has a short leg cast whichofthe following findingsshouldthenurseidentify asamanifestation ofthisconditionPain that increases with passive movement because compartment syndrome results from adecrease in blood flow in the extremitiesbecause of a decrease in the muscle compartment sizedue to acastthatis too tight56.Anurseisplanningcareforaclientwhoispost-operativefollowingalaparotomyandhas a closed suction drain which of the following actions should the nurse take to managethe drainCompress the drain Reservoir after emptying because it creates a vacuum that draws fluid out ofthe roomthroughthedrainand intothereservoir57.Apacunurseisassessingaclientwhoispost-operativefollowingarightnephrectomythe client's initial vital signs for heart rate 80 permanent blood pressure 130 over 70respiratoryrate16andtemperature96.8whichofthefollowingVitalsignchanges shouldalertthenursetheclientmightbehemorrhagingheartrateof110perminutebecauseoneofthefirstsignsofhemorrhage isanincrease intheheartratefromtheclientsBaselinewhichoccurstocompensateforblood58.A nurse is assessing a clientfollowing the completion of hemodialysis which of thefollowing findings isthenursespriority to reporttotheproviderRestlessness because using the Urgent vs. Non-virgin approach to client care the nurse todetermine thatthe priority funding to report to the provider is restlessness which can be anindicationoftheclientisexperiencingdisequilibriumsyndromewhichiscausedbytherapidremoval of electrolytes for the clients blood and can lead to dysrhythmias or seizures othermanifestationsincludenauseavomiting fatigueand headache59.A nurse is caring for a clientwho is having a seizure which of the following interventionsisthenurses priorityTurntheclienttothesidebecausethegreatestrisktothis clientishypoxiafromanimpairedAirway60.A nurse is obtaining a medication history from a client who is scheduled to undergocataractsurgerythenurseshouldrecognizethatwhichofthefollowingclientmedicationsisacontraindicationfor thesurgery and notify theproviderWarfarinbecauseitisananticoagulantwhichincreasestheclient'sriskforbleedingandiscontraindicatedforaclientscheduledforIorCentral NervousSystemsince surgery61.A nurse is providing teaching to a female client who has a history of urinary tractinfectionswhichofthefollowinginformationshouldthenurseincludeintheteachingClean the perineum from front to back after voiding or defecating to avoid introducing bacteriato theurethra62.A nurse is assessing a client who hashad a suspected cerebrovascular accident the nurseshouldplacethepriorityonwhich of thefollowingfindings

Page 15 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 15 preview image

Dysphasiabecauseitindicatesthattheclientisatgreatestriskforaspirationduetoimpairedsensation and functionwithintheoralcavity63.A nurse is planning care fora client who is post-operative following a parathyroidectomywhich ofthefollowing actionsshould thenurseidentify asthepriorityPlacedatracheostomy trayat the bedsideincase ofAirwayobstruction64.A nurse is providing teaching to a client whohas Type 1 diabetes mellitus and a newprescriptionforinsulinlisprowhichofthefollowing statementsbytheclientindicatesanunderstandingof theteachingI will need to take this bro in addition to my other prescribed insulin because it is a rapid-actinginsulinthat theclient canusein conjunctionwith anintermediateorlong-acting insulin65.A nurse is providing medicationteaching to a group of clients who have seizure disorderswhich ofthefollowing information shouldthenurseincludeaboutphenytoinPhenytoindecreasestheeffectivenessoforalcontraceptivesbecauseitstimulatesthesynthesisofhepatic enzymes which can decrease the activity of other medications including oralcontraceptives66.Anurseisprovidingdischargeinstructionstoa clientwhohasactive tuberculosiswhichofthe followinginformationshould the nurse includeintheinstructionsSputum specimens are necessary every 2 to 4 weeks until there are three negative cultures afterthreenegativesputum cultures theclientisno longerconsidered infectious67.A nurse is planning care for a client who was having a modified radical mastectomy ofthe right breast which of the following interventions should the nurse include in the planof careInstruct the client that the drain is removed when there is 25 milliliters of output or less over a24-hour period the drain will remain in place for one to three weeks after surgery and we'veremovedwhen there is 25 millilitersof outputorless in a 24-hour period68.A nurse is teaching to a client who has hypertension and anew prescription forVerapamil.WhichofthefollowingjuicesshouldthenurseinstructtheclienttoavoidGrapefruit because it inhibits the hepatic metabolism of the medication and then place the currentclient atrisk for toxicity69.Anurseisproviding teachingtoaclientwhohasasthmaaboutthe useofametered doseinhaler the nurse should identify that which of the following client actions indicates anunderstandingof theteachingHolding breath for 10 seconds after inhaling so that the medication can move deep into theAirways70.A nurse is providing instructions to a client whohas Type 2 diabetes mellitus and a newprescription for metformin which of the following statements by the client indicates anunderstandingof theteachingIshouldtakethismedicationwithamealtoimproveabsorptionandtominimizegastrointestinaldistress71.Anurseisproviding teachingtoaclientwhohasirritable bowelsyndromewhichofthefollowing instructions should thenurseincludein teachingIncrease fiber intake to at least 30 grams per day to produce bulky soft stools and establishregularbowelpatterns72.A nurse in an emergency department isassessing an older adult client who has a fracturedwristfollowing afallduringtheassessmenttheclientstateslastweekIcrashedmycar

Page 16 of 16

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 16 preview image

becausemyvision suddenlybecameblurry whichofthefollowingactionsisthenursespriorityChecktheclients neurologicstatusbecausethefirstactionyoushouldtakeistoassesstheclient73.Anurseisproviding teachingtoaclientwhohasanewprescriptionforpsylliumwhichofthefollowing information shouldthenurse include in the teachingDrink240millilitersofwaterafterAdministration74.A nurse on a medical-surgical unitis receiving change of shift report on four clientswhich of the following clients should the nurse identify as having the greatest risk fordevelopinganinfection75.A client who has COPD and is receiving steroid therapy because of decreasedoxygenation andincreased mucus production additionally taking a steroid medicationincreasestheclient'sriskforinfectionbysuppressingtheimmunesystemandmaskingthe presenceof an infection76.A nurse is planning dischargeteaching for a client who has an external fixation device fora fracture of the lower extremity which of the following instructions should the nurseincludeintheplanof careUsedcrutches withrubbertipstoprevent theclientfromslippinganddecreasethe riskofFalls77.Anurse inanemergencydepartmentiscaringfor aclientwhohas fullthicknessBurnsover20%ofhistotalbodysurfaceareaafterensuringapatentAirwayandadministeringoxygen which ofthefollowingitemsshouldthe nursepreparedto administerfirstIVfluidstoprovidecirculatory support78.A nurse is reviewing the medical record of a client who has osteomyelitis and aprescription for Gentamicin which of the following findings from the client's medicalrecordshouldindicate tothenursethe needto withholdthemedicationandnotifytheproviderSerum creatinine because a client who has an elevated serum creatinine level should not receiveGentamicinbecausethemedication is nephrotoxic79.A nurse is reviewing the laboratory results of a client who has a new diagnosis of acuteleukemiawhichofthefollowingfindingsshouldthenurseidentifyasanexpectedfindingIncreasedwhite bloodcellcount dotooverproductionofwhitebloodcellsbythebone marrow80.A nurse in an emergency department is caring for a client who reports vomiting anddiarrhea for the past 3 days which of the following findings should indicate to the nursethattheclientis experiencing fluidvolumedeficitHeartrateof110perminute81.Anurseisprovidingpreoperativeteachingforaclientwhois scheduledforan opencholecystectomy which of thefollowing actionsshould thenursetakeDemonstratewaystodeepbreatheandcoughtopreventrespiratorycomplications82.A nurse is caring for a clientwho is receiving mechanical ventilation via a tracheostomyto the nurse should recognize that which of the following complications is associatedwith long-termmechanicalventilationStressulcersbecauseofelevatedlevelsofhydrochloricacidinthestomach.Theyincreaseriskforsystemicinfectionand requirepharmtreatment83.A nurse is providing discharge instructions to a client who has laryngeal cancer andreceived is receiving radiation treatment which of the following statements by the clientindicatesan understandingof theteaching

Preview Mode

This document has 62 pages. Sign in to access the full document!

Report

Learning Tools

Writing Tools

Browse Resources

2023 ATI Medical Surgical Practice Exam With Answers (184 Solved Questions) - Page 1

Study Now!

Document Details

Related Documents

ATI TEAS Prep Plus: 2 Practice Tests + Proven Strategies [Excluded Online Resource] (Kaplan Test Prep) (2019)

2023 NGN ATI RN Med Surg Proctored Exam with Answers (240 Solved Questions)

2019 ATI RN Maternal Newborn with Answers (70 Solved Questions)

2023 NGN ATI RN Comprehensive Predictor Retake Exam with Answers (177 Solved Questions)

2013 ATI RN Proctored Pharmacology Form B with Answers (70 Solved Questions)

2023 ATI Nutrition Proctored Exam with Answers (121 Solved Questions)

ATI RN Maternal Newborn NGN Proctored Exam with Answers (250 Solved Questions)

ATI Pharmacology Proctored Test Bank with Answers (313 Solved Questions)

2022-2023 ATI Leadership Proctored Focus Practice Exam with Answers (63 Solved Questions)

2024 ATI RN Predictor Practice Exam with Answers (136 Solved Questions)

Company

Explore

Study Tools